PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn273891
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family Nin-like
Protein Properties Length: 531aa    MW: 59968.2 Da    PI: 5.9882
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn273891genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK56.46e-18268316452
      RWP-RK   4 eisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                 ei  ed+ +y +l+  dAA++L+v+ ++ Kr CRq+GI+RWP Rk+ ++
  Achn273891 268 EIPYEDILHYSKLSRSDAARNLEVSISTFKRVCRQHGISRWPPRKVDKV 316
                 57789*****************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151913.936252336IPR003035RWP-RK domain
PfamPF020422.8E-15270316IPR003035RWP-RK domain
SuperFamilySSF542771.18E-9355446No hitNo description
Gene3DG3DSA:3.10.20.2402.5E-8361438No hitNo description
PROSITE profilePS5174514.614361445IPR000270PB1 domain
SMARTSM006662.6E-7361445IPR000270PB1 domain
PfamPF005642.4E-10361424IPR000270PB1 domain
CDDcd059922.75E-7362423No hitNo description
PROSITE profilePS5174521.79447530IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2406.5E-15447519No hitNo description
SuperFamilySSF542778.41E-14447523No hitNo description
SMARTSM006663.6E-16447530IPR000270PB1 domain
PfamPF005649.0E-16448526IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 531 aa     Download sequence    Send to blast
MAVLSKQKKK NNKAHQDALM KIERVLKLVC KIHEIPLALT WVPCGACETL LPIKEDLCIF  60
WDYNDVTISD LYDFLMSRFG PPLRNGIGVV GRALTSPNLL YCSDVTQFSM AEYPWAHFAR  120
QCRLRDCFAI SLWSNYTGND IYVLEIFLPA SNTDEDSFTS LSKILETMKK EFKTFRFASG  180
EELGEELSVE VIEFQNGQKR HYVQTLHVTG SLPSLEPLQN GGEIMQVDSS DHQSIDAEQC  240
EIDANHPQEL GTNKTLGREH KNTGVRIEIP YEDILHYSKL SRSDAARNLE VSISTFKRVC  300
RQHGISRWPP RKVDKVRHPR PSHVDHHEEV PQLISNLPSN QASARIAHTQ PHDTALQIAN  360
TVNVKAKYVK GLTLLFPLSL SSTLEELYEC IETRLDLSRG TYHACYIDGD NDKITVTCDQ  420
DLQVWLCDSP RLSGSSAVVL HIDPVSQVTV RAKYVNDITI KFQLSLSSGL VELQQQVAKR  480
LNLEAGSYHI KYKDEEDELI LIACDEDLQD CIHTCRSLDS TSIAVLLELK *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.18e-51Nin-like family protein